Running ORFold:#
Inputs#
Basically, ORFold requires only a fasta file containing the amino acid sequences to treat (given with the -fna label). ORFold can handle several fasta files at the same time. In this case, it will treat them independently and will generate as many outputs as entered fasta files. The inputs must be stored in a local directory that will be linked to the /database/ directory of the container (see here for more details). The following commands assume the user run ORFold in the container and all necessary inputs are stored in the /database/ folder of the container.
fasta file example:
>aminoacid_sequence_1
AGNVCFGGRTYMPDFDGMSCVNWQERT
>aminoacid_sequence_2
MPDFMPCNVSDRTEEEPMSPARTYDFGHKLCVSDFTPMLKKPERT
How to estimate the fold potential and/or disorder and aggregation propensities#
By default, ORFold only estimates the fold potential of the input sequences. The disorder and aggregation propensities can be however calculated as well. The user can specify which calculation methods are to be launched with the -options argument.
Each method used by ORFold is referred by its initial:
HCA : H IUPred : I TANGO : T
The user must specify the combination of methods he wants to apply
on the input sequences giving their initials with the -options argument
without any space: -options HIT
for running the 3 programs or -options HT
if the user wants to run only HCA and Tango for example.
The order of the letters has no importance,
-options HIT
and -options THI
will lead to the same result.
Basic run#
The following instruction estimates the fold potential, and the disorder and aggregation propensities of all amino acid sequences contained in the input fASTA file:
orfold -faa /database/sequences.fasta -options HIT
The user has to notice that IUPred and Tango provide additional information to HCA but will slow down considerably ORFold for large datasets. The next instruction only calculate the fold potential with HCA:
orfold -fna /database/sequences.fasta -options H
Output:#
ORFold produces a table (fasta_rootname.tab) that contains for each input sequence, the computed values (separated by tabulations) according to the user request (fold potential, and/or disorder and/or aggregation propensities). The output(s) is/are stored in the /workdir/orfold/ directory of the container.
Output file example with -options HIT
(fold potential, disorder and aggregation
propensities estimated from HCA, IUPred and Tango, see here for more details):
Seq_ID HCA Disord Aggreg
aminoacid_sequence_1 1.340 0.000 0.230
aminoacid_sequence_2 -0.230 0.120 0.012
Output file example with -options H
(fold potential estimated with HCA, see here for more details):
Seq_ID HCA Disord Aggreg
aminoacid_sequence_1 1.340 nan nan
aminoacid_sequence_2 -0.230 nan nan